LIVIVO - The Search Portal for Life Sciences

zur deutschen Oberfläche wechseln
Advanced search

Search results

Result 1 - 7 of total 7

Search options

  1. Article ; Online: Essentiality of Nfatc1 short isoform in osteoclast differentiation and its self-regulation.

    Omata, Yasuhiro / Tachibana, Hideyuki / Aizaki, Yoshimi / Mimura, Toshihide / Sato, Kojiro

    Scientific reports

    2023  Volume 13, Issue 1, Page(s) 18797

    Abstract: During osteoclast differentiation, the expression of the transcription factor nuclear factor of activated T cell 1 (Nfatc1) increases in an autoproliferative manner. Nfatc1 isoforms are of three sizes, and only the short isoform increases during ... ...

    Abstract During osteoclast differentiation, the expression of the transcription factor nuclear factor of activated T cell 1 (Nfatc1) increases in an autoproliferative manner. Nfatc1 isoforms are of three sizes, and only the short isoform increases during osteoclast differentiation. Genetic ablation of the whole Nfatc1 gene demonstrated that it is essential for osteoclastogenesis; however, the specific role of the Nfatc1 short form (Nfatc1/αA) remains unknown. In this study, we engineered Nfatc1 short form-specific knockout mice and found that these mice died in utero by day 13.5. We developed a novel osteoclast culture system in which hematopoietic stem cells were cultured, proliferated, and then differentiated into osteoclasts in vitro. Using this system, we show that the Nfatc1/αA isoform is essential for osteoclastogenesis and is responsible for the expression of various osteoclast markers, the Nfatc1 short form itself, and Nfatc1 regulators.
    MeSH term(s) Mice ; Animals ; Osteoclasts/metabolism ; NFATC Transcription Factors/genetics ; NFATC Transcription Factors/metabolism ; T-Lymphocytes/metabolism ; Cell Differentiation/genetics ; Protein Isoforms/genetics ; Protein Isoforms/metabolism ; Self-Control ; RANK Ligand/metabolism
    Chemical Substances NFATC Transcription Factors ; Protein Isoforms ; RANK Ligand ; Nfatc1 protein, mouse
    Language English
    Publishing date 2023-11-01
    Publishing country England
    Document type Journal Article ; Research Support, Non-U.S. Gov't
    ZDB-ID 2615211-3
    ISSN 2045-2322 ; 2045-2322
    ISSN (online) 2045-2322
    ISSN 2045-2322
    DOI 10.1038/s41598-023-45909-3
    Database MEDical Literature Analysis and Retrieval System OnLINE

    More links

    Kategorien

    Order via subito

    This service is chargeable due to the Delivery terms set by subito. Orders including an article and supplementary material will be classified as separate orders. In these cases, fees will be demanded for each order.

  2. Book ; Online: gSwin

    Go, Mocho / Tachibana, Hideyuki

    Gated MLP Vision Model with Hierarchical Structure of Shifted Window

    2022  

    Abstract: Following the success in language domain, the self-attention mechanism (transformer) is adopted in the vision domain and achieving great success recently. Additionally, as another stream, multi-layer perceptron (MLP) is also explored in the vision domain. ...

    Abstract Following the success in language domain, the self-attention mechanism (transformer) is adopted in the vision domain and achieving great success recently. Additionally, as another stream, multi-layer perceptron (MLP) is also explored in the vision domain. These architectures, other than traditional CNNs, have been attracting attention recently, and many methods have been proposed. As one that combines parameter efficiency and performance with locality and hierarchy in image recognition, we propose gSwin, which merges the two streams; Swin Transformer and (multi-head) gMLP. We showed that our gSwin can achieve better accuracy on three vision tasks, image classification, object detection and semantic segmentation, than Swin Transformer, with smaller model size.

    Comment: 5 pages, 7 figures, IEEE ICASSP 2023
    Keywords Computer Science - Computer Vision and Pattern Recognition ; Computer Science - Machine Learning
    Publishing date 2022-08-24
    Publishing country us
    Document type Book ; Online
    Database BASE - Bielefeld Academic Search Engine (life sciences selection)

    Full text online

    More links

    Kategorien

    Inter-library loan at ZB MED

    Your chosen title can be delivered directly to ZB MED Cologne location if you are registered as a user at ZB MED Cologne.

  3. Article ; Online: Relapsing Polychondritis and Aseptic Meningoencephalitis.

    Yokota, Kazuhiro / Tachibana, Hideyuki / Miyake, Akifumi / Yamamoto, Toshimasa / Mimura, Toshihide

    Internal medicine (Tokyo, Japan)

    2022  Volume 62, Issue 3, Page(s) 481–486

    Abstract: We herein report a 49-year-old Japanese man with relapsing polychondritis (RP) and aseptic meningoencephalitis. Four years ago, the patient was diagnosed with RP. Prednisolone (PSL) was started at 30 mg/day, and the symptoms promptly disappeared. However, ...

    Abstract We herein report a 49-year-old Japanese man with relapsing polychondritis (RP) and aseptic meningoencephalitis. Four years ago, the patient was diagnosed with RP. Prednisolone (PSL) was started at 30 mg/day, and the symptoms promptly disappeared. However, cognitive impairment gradually appeared from six months before hospitalization. Methylprednisolone pulse therapy was immediately initiated, followed by administration of PSL at 1 mg/kg/day. Intravenous cyclophosphamide was combined with PSL. After treatment, the patient's cognitive impairment clearly improved. In conclusion, RP rarely causes aseptic meningoencephalitis, highlighting the need for prompt and aggressive immunosuppressive therapy.
    MeSH term(s) Male ; Humans ; Middle Aged ; Polychondritis, Relapsing/complications ; Polychondritis, Relapsing/diagnosis ; Polychondritis, Relapsing/drug therapy ; Meningoencephalitis/complications ; Meningoencephalitis/diagnosis ; Meningoencephalitis/drug therapy ; Prednisolone/therapeutic use ; Cyclophosphamide/therapeutic use ; Immunosuppression Therapy/adverse effects
    Chemical Substances Prednisolone (9PHQ9Y1OLM) ; Cyclophosphamide (8N3DW7272P)
    Language English
    Publishing date 2022-07-14
    Publishing country Japan
    Document type Case Reports ; Journal Article
    ZDB-ID 32371-8
    ISSN 1349-7235 ; 0021-5120 ; 0918-2918
    ISSN (online) 1349-7235
    ISSN 0021-5120 ; 0918-2918
    DOI 10.2169/internalmedicine.9411-22
    Database MEDical Literature Analysis and Retrieval System OnLINE

    More links

    Kategorien

    In stock of ZB MED Cologne/Königswinter

    Zs.A 240: Show issues Location:
    Je nach Verfügbarkeit (siehe Angabe bei Bestand)
    bis Jg. 1994: Bestellungen von Artikeln über das Online-Bestellformular
    Jg. 1995 - 2021: Lesesall (1.OG)
    ab Jg. 2022: Lesesaal (EG)

    Order via subito

    This service is chargeable due to the Delivery terms set by subito. Orders including an article and supplementary material will be classified as separate orders. In these cases, fees will be demanded for each order.

  4. Book ; Online: Efficiently Trainable Text-to-Speech System Based on Deep Convolutional Networks with Guided Attention

    Tachibana, Hideyuki / Uenoyama, Katsuya / Aihara, Shunsuke

    2017  

    Abstract: This paper describes a novel text-to-speech (TTS) technique based on deep convolutional neural networks (CNN), without use of any recurrent units. Recurrent neural networks (RNN) have become a standard technique to model sequential data recently, and ... ...

    Abstract This paper describes a novel text-to-speech (TTS) technique based on deep convolutional neural networks (CNN), without use of any recurrent units. Recurrent neural networks (RNN) have become a standard technique to model sequential data recently, and this technique has been used in some cutting-edge neural TTS techniques. However, training RNN components often requires a very powerful computer, or a very long time, typically several days or weeks. Recent other studies, on the other hand, have shown that CNN-based sequence synthesis can be much faster than RNN-based techniques, because of high parallelizability. The objective of this paper is to show that an alternative neural TTS based only on CNN alleviate these economic costs of training. In our experiment, the proposed Deep Convolutional TTS was sufficiently trained overnight (15 hours), using an ordinary gaming PC equipped with two GPUs, while the quality of the synthesized speech was almost acceptable.

    Comment: 5 pages, 3figures, IEEE ICASSP 2018
    Keywords Computer Science - Sound ; Computer Science - Artificial Intelligence ; Computer Science - Machine Learning ; Electrical Engineering and Systems Science - Audio and Speech Processing
    Subject code 006
    Publishing date 2017-10-24
    Publishing country us
    Document type Book ; Online
    Database BASE - Bielefeld Academic Search Engine (life sciences selection)

    Full text online

    More links

    Kategorien

    Inter-library loan at ZB MED

    Your chosen title can be delivered directly to ZB MED Cologne location if you are registered as a user at ZB MED Cologne.

  5. Article ; Online: Endogenous endophthalmitis secondary to septic arthritis caused by group A Streptococcus infection: A case report and literature review.

    Imai, Kazuo / Tarumoto, Norihito / Tachibana, Hideyuki / Hanabusa, Aya / Sakai, Jun / Yokota, Kazuhiro / Mimura, Toshihide / Maesaki, Shigefumi

    Journal of infection and chemotherapy : official journal of the Japan Society of Chemotherapy

    2019  Volume 26, Issue 1, Page(s) 128–131

    Abstract: Streptococcus pyogenes is a rare pathogen that causes endogenous endophthalmitis (EE). A healthy 58-year-old woman was diagnosed with EE secondary to septic arthritis caused by S. pyogenes. She underwent enucleation after hospitalization for 14 days with ...

    Abstract Streptococcus pyogenes is a rare pathogen that causes endogenous endophthalmitis (EE). A healthy 58-year-old woman was diagnosed with EE secondary to septic arthritis caused by S. pyogenes. She underwent enucleation after hospitalization for 14 days with appropriate antibiotic cover. A literature search for outcomes of this condition revealed reports on only 10 eyes among 8 cases identified: 8 eyes (80%) developed poor visual outcome and 5 eyes (50%) underwent enucleation. There were no cases with immunocompromise. Our case report and literature review suggest the importance of awareness of the occurrence of S. pyogenes infection in immunocompetent hosts, and thus early diagnosis and aggressive treatment may be required to improve visual outcome.
    MeSH term(s) Anti-Bacterial Agents/therapeutic use ; Arthritis, Infectious/complications ; Arthritis, Infectious/microbiology ; Endophthalmitis/diagnosis ; Endophthalmitis/microbiology ; Endophthalmitis/therapy ; Eye Enucleation ; Female ; Humans ; Middle Aged ; Streptococcal Infections/diagnosis ; Streptococcal Infections/microbiology ; Streptococcal Infections/therapy ; Streptococcus pyogenes
    Chemical Substances Anti-Bacterial Agents
    Language English
    Publishing date 2019-07-09
    Publishing country Netherlands
    Document type Case Reports ; Journal Article
    ZDB-ID 1355399-9
    ISSN 1437-7780 ; 1341-321X
    ISSN (online) 1437-7780
    ISSN 1341-321X
    DOI 10.1016/j.jiac.2019.06.008
    Database MEDical Literature Analysis and Retrieval System OnLINE

    More links

    Kategorien

    In stock of ZB MED Cologne/Königswinter

    Zs.A 5236: Show issues Location:
    Je nach Verfügbarkeit (siehe Angabe bei Bestand)
    bis Jg. 1994: Bestellungen von Artikeln über das Online-Bestellformular
    Jg. 1995 - 2021: Lesesall (2.OG)
    ab Jg. 2022: Lesesaal (EG)

    Order via subito

    This service is chargeable due to the Delivery terms set by subito. Orders including an article and supplementary material will be classified as separate orders. In these cases, fees will be demanded for each order.

  6. Article ; Online: A significant induction of neutrophilic chemoattractants but not RANKL in synoviocytes stimulated with interleukin 17.

    Ota, Muneo / Yanagisawa, Maiko / Tachibana, Hideyuki / Yokota, Kazuhiro / Araki, Yasuto / Sato, Kojiro / Mimura, Toshihide

    Journal of bone and mineral metabolism

    2014  Volume 33, Issue 1, Page(s) 40–47

    Abstract: Interleukin 17 (IL-17) is a cytokine implicated in the promotion of osteoclastogenesis. Its effect has been believed not to be directly exerted on osteoclast precursors, but rather indirectly carried out via an induction of receptor activator of NF-κB ... ...

    Abstract Interleukin 17 (IL-17) is a cytokine implicated in the promotion of osteoclastogenesis. Its effect has been believed not to be directly exerted on osteoclast precursors, but rather indirectly carried out via an induction of receptor activator of NF-κB ligand (RANKL), the osteoclast differentiation factor, on osteoclast-supporting cells, which in turn exert an effect on osteoclast precursors. The mechanistic details, however, remain unclear. In this study, we first performed a transcriptome analysis of synoviocytes derived from a patient with rheumatoid arthritis cultured in the presence or absence of IL-17. We discovered that most of the genes significantly induced by IL-17 were chemokines with a chemotactic effect on neutrophils. We confirmed these results by quantitative RT-PCR and ELISA. Unexpectedly, the stimulation with IL-17 alone did not induce the expression of RANKL either at the mRNA or the protein level. The induction of RANKL was observed when IL-17 was added in combination with 1,25-dihydroxyvitamin D3 and prostaglandin E2, well-known inducers of RANKL, although the exact mechanism of this synergistic effect remains unclear. IL-6 and monocyte chemoattractant protein-1 were also significantly induced by IL-17 at both the mRNA and protein levels. Thus, it appears that IL-17 induces the migration of neutrophils and monocytes/macrophages through the activation of synoviocytes, and enhances a positive feedback loop composed of proinflammatory cytokines IL-6 and IL-17.
    MeSH term(s) Arthritis, Rheumatoid/metabolism ; Cell Lineage ; Cell Movement ; Chemokine CCL2/metabolism ; Chemokines/metabolism ; Chemotactic Factors/metabolism ; Dinoprostone/metabolism ; Ergocalciferols/metabolism ; Humans ; Interleukin-17/pharmacology ; Interleukin-6/metabolism ; Neutrophils/cytology ; Osteoblasts/metabolism ; Osteoclasts/cytology ; RANK Ligand/metabolism ; Synovial Membrane/cytology
    Chemical Substances CCL2 protein, human ; Chemokine CCL2 ; Chemokines ; Chemotactic Factors ; Ergocalciferols ; IL6 protein, human ; Interleukin-17 ; Interleukin-6 ; RANK Ligand ; TNFSF11 protein, human ; 1,25-dihydroxyergocalciferol (55248-15-2) ; Dinoprostone (K7Q1JQR04M)
    Language English
    Publishing date 2014-02-21
    Publishing country Japan
    Document type Journal Article ; Research Support, Non-U.S. Gov't
    ZDB-ID 1295123-7
    ISSN 1435-5604 ; 0914-8779
    ISSN (online) 1435-5604
    ISSN 0914-8779
    DOI 10.1007/s00774-014-0565-y
    Database MEDical Literature Analysis and Retrieval System OnLINE

    Full text online

    More links

    Kategorien

    In stock of ZB MED Cologne/Königswinter

    Zs.A 4894: Show issues Location:
    Je nach Verfügbarkeit (siehe Angabe bei Bestand)
    bis Jg. 1994: Bestellungen von Artikeln über das Online-Bestellformular
    Jg. 1995 - 2021: Lesesall (2.OG)
    ab Jg. 2022: Lesesaal (EG)

    Order via subito

    This service is chargeable due to the Delivery terms set by subito. Orders including an article and supplementary material will be classified as separate orders. In these cases, fees will be demanded for each order.

  7. Article: Purification and expression of a processing protease on beta-alanine-oxoglutarate aminotransferase from rat liver mitochondria.

    Ohyama, Tomoko / Matsuda, Koichi / Tachibana, Hideyuki / Fujimoto Sakata, Shigeko / Mori, Masataka / Horiuchi, Masahisa / Tamaki, Nanaya

    FEBS letters

    2004  Volume 572, Issue 1-3, Page(s) 251–255

    Abstract: GABA[arrow beta]AlaAT convertase is an endopeptidase that processes brain-type 4-aminobutyrate aminotransferase (GABA AT; EC 2.6.1.19) to liver-type beta-alanine-oxoglutarate aminotransferase (beta-AlaAT I) in rats. Its molecular mass was 180 kDa as ... ...

    Abstract GABA[arrow beta]AlaAT convertase is an endopeptidase that processes brain-type 4-aminobutyrate aminotransferase (GABA AT; EC 2.6.1.19) to liver-type beta-alanine-oxoglutarate aminotransferase (beta-AlaAT I) in rats. Its molecular mass was 180 kDa as determined by gel filtration. A subunit molecular mass of 97652 Da was measured using MALDI-TOF MS. The N-terminal sequence of the purified GABA[arrow beta]AlaAT convertase was SRVEVSKVLILGSGGLSIGQAGEFDYSGSQAV- and was identical to residues 418-449 of carbamoyl-phosphate synthetase I (CPS I; EC 1.2.1.27) purified from rat liver. The subunit molecular mass and the N-terminal amino acid sequence suggested that GABA[arrow beta]AlaAT convertase was the 418-1305 peptide of CPS I. An expression vector containing the coding region of the 418-1305 peptide of rat CPS I was transfected into NIH3T3 cells and the extract of the cells showed GABA[arrow beta]AlaAT convertase activity.
    MeSH term(s) 3T3 Cells ; Alanine Transaminase/chemistry ; Alanine Transaminase/genetics ; Alanine Transaminase/metabolism ; Amino Acid Sequence ; Animals ; Conserved Sequence ; Endopeptidases/metabolism ; Humans ; Male ; Mice ; Mitochondria, Liver/enzymology ; Molecular Sequence Data ; Rats ; Rats, Wistar ; Recombinant Proteins/metabolism ; Sequence Alignment ; Sequence Homology, Amino Acid ; Swine ; Transaminases/chemistry ; Transaminases/genetics ; Transaminases/metabolism ; Transfection
    Chemical Substances Recombinant Proteins ; Transaminases (EC 2.6.1.-) ; beta-alanine-oxoglutarate aminotransferase, rat (EC 2.6.1.-) ; Alanine Transaminase (EC 2.6.1.2) ; Endopeptidases (EC 3.4.-)
    Language English
    Publishing date 2004-08-13
    Publishing country England
    Document type Journal Article
    ZDB-ID 212746-5
    ISSN 1873-3468 ; 0014-5793
    ISSN (online) 1873-3468
    ISSN 0014-5793
    DOI 10.1016/j.febslet.2004.07.043
    Database MEDical Literature Analysis and Retrieval System OnLINE

    Full text online

    More links

    Kategorien

    In stock of ZB MED Cologne/Königswinter

    Zs.B 282: Show issues Location:
    Je nach Verfügbarkeit (siehe Angabe bei Bestand)
    bis Jg. 2021: Bestellungen von Artikeln über das Online-Bestellformular
    ab Jg. 2022: Lesesaal (EG)

    Order via subito

    This service is chargeable due to the Delivery terms set by subito. Orders including an article and supplementary material will be classified as separate orders. In these cases, fees will be demanded for each order.

To top